PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009759078.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 903aa    MW: 101146 Da    PI: 5.9076
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009759078.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.31.7e-29582633152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+le l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  XP_009759078.1 582 AEKTITLEILQQYFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 633
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.575570653IPR003035RWP-RK domain
PfamPF020429.5E-26585633IPR003035RWP-RK domain
SuperFamilySSF542777.85E-23798886No hitNo description
PROSITE profilePS5174525.328802886IPR000270PB1 domain
SMARTSM006668.7E-24802885IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-21803881No hitNo description
CDDcd064071.52E-39804885No hitNo description
PfamPF005641.3E-18804883IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 903 aa     Download sequence    Send to blast
MDETVIPSNP LLTNQSDYFM DLDYVDGLLL EGCWLETTDG NEFLQNSPAN FNAPFDSSFM  60
WPNTIDTNNV EFNGIPSKDF QEEKQIQPFG ENVNNAMCTS GQSESHFVEA PELNRRWWFG  120
PKASSSVMDR LIWALGHIRD CSRDKDILLQ LWVPINRDGR HVLSTTDQPF LLDLNCPRLA  180
NYRQVSVNYQ FPANEDSKEI VGLPGRVFAD KVPEWSPDVR FFRSEEYPRV EHAQQYDVRG  240
TLAVPVFEQG SRNCLGVIEV VMTTQKIKYR PELESVCEAL KAVNLRTSEV STTQNAKVCD  300
LSYQAALPEI LEVLKSACET HGLPLAQTWV PCVQQGKGGC RHSEENLIHC VSTEDSACYV  360
ADPHVRGFHE ACSEHHLLKG QGVVGRAFMT NQPCFSADLT SYSKTEYPLS HHAQMFGLQA  420
AVAIRLRSIS TGSCDFVLEF FLPSDCRNPE EHRKMLTSLS IIIQNVCRTL RVVTDKELQE  480
EAVSIGEAAN PSFIRSNKEQ TETSQERTSW TSCDAEFQES STVVSAFHDE KPDEMLRKEP  540
VEFRHHNDSD YGMDFALNEN HCASGEGVSR NGKKGDRRRT KAEKTITLEI LQQYFAGSLK  600
DAAKSIGVCP TTLKRICRQH GIKRWPSRKI KKVGHSLQKI QRVIDSVQGA SGSLQIESFY  660
SNFPELASPN VSRLSPFANS KSNEHPKALN AQQEGCVMSP HAAASKSPSS SCSRSSSSSQ  720
CCSSGTKPQS SPLSIAGNDD PIVQEESVDN AVKRVKSEPE LHLSSETLKI LPRSQSHACV  780
AENPKSESLL VKKGPLRSQE EAPRVKVTHG EEKIRFRMQN SWRYSELLRE ITRRFGIDDP  840
SGLQLKYMDD DSEWVLLTCD ADLEECLDVC MSSQNQMIKL ILVRDSQHHI GSSFGSSSPI  900
LVQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759077.10.0PREDICTED: protein NLP4-like
RefseqXP_009759078.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0V0IWK30.0A0A0V0IWK3_SOLCH; Uncharacterized protein
TrEMBLM1ALT30.0M1ALT3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000256570.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein